Structure of PDB 6orl Chain A Binding Site BS02

Receptor Information
>6orl Chain A (length=246) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLPKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIM
SASEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTS
ACTVAVMPELPDAELPDINPADLRIDTFRTDSAIRITHLPTGIVVECQDE
RSQHKNKAKALSVLGARIHAAEMAKRQQAEASTRRNLLGSGDRSDRNRTY
NFPQGRVTDHRINLTLYRLDEVMEGKLDMLIEPIIQEHQADQLAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6orl The structural basis for release-factor activation during translation termination revealed by time-resolved cryogenic electron microscopy.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		E191 R195 H197
Binding residue
(residue number reindexed from 1)		E92 R96 H98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0016149 translation release factor activity, codon specific
Biological Process
GO:0006415 translational termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6orl, PDBe:6orl, PDBj:6orl
PDBsum6orl
PubMed31189921
UniProtP0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]