Structure of PDB 6om4 Chain A Binding Site BS02

Receptor Information

>6om4 Chain A (length=345) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSS
YTAALETANIPEKDFSNCFRFLKENFFIIPSEYNNNNRYSRNFLHYQSYG
ANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENT
NLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKV
PEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPG
KTGCYECQKVVADLYGAEKENIDHKIKLINSRFKPATFAPVNNVAAALCA
ADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN

Ligand information

>6om4 Chain D (length=7) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MRTGNAD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6om4 Biosynthesis of the RiPP trojan horse nucleotide antibiotic microcin C is directed by theN-formyl of the peptide precursor.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	K10 L19 G23 E26
Binding residue (residue number reindexed from 1)	K10 L19 G23 E26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004792	thiosulfate sulfurtransferase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008641	ubiquitin-like modifier activating enzyme activity
GO:0016779	nucleotidyltransferase activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6om4, PDBe:6om4, PDBj:6om4
PDBsum	6om4
PubMed	30881667
UniProt	Q47506

[Back to BioLiP]