Structure of PDB 6ogk Chain A Binding Site BS02

Receptor Information
>6ogk Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELI
AYFEKVGDTSLDPNDFDFTVTGRGSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ogk Plasticity at the DNA recognition site of the MeCP2 mCG-binding domain.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		K109 R111 K112 S113 R115 S116 R133
Binding residue
(residue number reindexed from 1)		K20 R22 K23 S24 R26 S27 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ogk, PDBe:6ogk, PDBj:6ogk
PDBsum6ogk
PubMed31356990
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]