Structure of PDB 6ogj Chain A Binding Site BS02

Receptor Information
>6ogj Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYF
EKVGDTSLDPNDFDFTVTGRGSPSAHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ogj Plasticity at the DNA recognition site of the MeCP2 mCG-binding domain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V136 T158 V159 T160
Binding residue
(residue number reindexed from 1)		V44 T66 V67 T68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ogj, PDBe:6ogj, PDBj:6ogj
PDBsum6ogj
PubMed31356990
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]