Structure of PDB 6od5 Chain A Binding Site BS02

Receptor Information
>6od5 Chain A (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVA
VILSLEQQVRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6od5 Structural basis for preferential binding of human TCF4 to DNA containing 5-carboxylcytosine.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		R570 N573 N574 E577 R578 N585 T606 K607
Binding residue
(residue number reindexed from 1)		R4 N7 N8 E11 R12 N19 T40 K41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6od5, PDBe:6od5, PDBj:6od5
PDBsum6od5
PubMed31081034
UniProtP15884|ITF2_HUMAN Transcription factor 4 (Gene Name=TCF4)

[Back to BioLiP]