Structure of PDB 6nqa Chain A Binding Site BS02

Receptor Information
>6nqa Chain A (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVKALQEASEAYLVALFEDTNLCAIHAKRVTIKPKDIQLARRIRGER
Ligand information
>6nqa Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nqa Mechanism of Cross-talk between H2B Ubiquitination and H3 Methylation by Dot1L.
Resolution3.54 Å
Binding residue
(original residue number in PDB)
Y41 G44 V46 R63 L65
Binding residue
(residue number reindexed from 1)
Y4 G7 V9 R26 L28
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6nqa, PDBe:6nqa, PDBj:6nqa
PDBsum6nqa
PubMed30765112
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]