Structure of PDB 6n6k Chain A Binding Site BS02

Receptor Information
>6n6k Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQ
PDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPG
LCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYE
FAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n6k A dedicated diribonucleotidase resolves a key bottleneck for the terminal step of RNA degradation.
Resolution1.418 Å
Binding residue
(original residue number in PDB)		Y132 R133
Binding residue
(residue number reindexed from 1)		Y129 R130
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6n6k, PDBe:6n6k, PDBj:6n6k
PDBsum6n6k
PubMed31225796
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]