Structure of PDB 6n6i Chain A Binding Site BS02

Receptor Information

>6n6i Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQ
PDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPG
LCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYE
FAPKKAASHRALDDISESIKELQFYRNNIFKKK

Ligand information

>6n6i Chain C (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6n6i A dedicated diribonucleotidase resolves a key bottleneck for the terminal step of RNA degradation.
Resolution	1.431 Å
Binding residue (original residue number in PDB)	Y132 R133
Binding residue (residue number reindexed from 1)	Y129 R130

Enzymatic activity

Enzyme Commision number

3.1.15.-

Gene Ontology

	Molecular Function
GO:0000175	3'-5'-RNA exonuclease activity
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:6n6i, PDBe:6n6i, PDBj:6n6i
PDBsum	6n6i
PubMed	31225796
UniProt	Q9Y3B8\|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]