Structure of PDB 6muo Chain A Binding Site BS02

Receptor Information
>6muo Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQA
LLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGL
Ligand information
>6muo Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgaggaagttcatataaaaggcaaacggaagcattctcagaatattct
ttgtgatgatggagtttcactcacagagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatatttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6muo Structure of the Human Core Centromeric Nucleosome Complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		G46 R63 K64 L65
Binding residue
(residue number reindexed from 1)		G6 R23 K24 L25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6muo, PDBe:6muo, PDBj:6muo
PDBsum6muo
PubMed31353180
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]