Structure of PDB 6mrj Chain A Binding Site BS02

Receptor Information
>6mrj Chain A (length=134) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAED
NPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNC
LETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mrj Crystal structure of H.pylori NikR in complex with DNA
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R12 S36 R37 S38 R42
Binding residue
(residue number reindexed from 1)		R5 S29 R30 S31 R35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mrj, PDBe:6mrj, PDBj:6mrj
PDBsum6mrj
PubMed
UniProtO25896|NIKR_HELPY Putative nickel-responsive regulator (Gene Name=HP_1338)

[Back to BioLiP]