Structure of PDB 6ml6 Chain A Binding Site BS02

Receptor Information
>6ml6 Chain A (length=143) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKK
HLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSD
SSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ml6 Structural basis of specific DNA binding by the transcription factor ZBTB24.
Resolution1.54 Å
Binding residue
(original residue number in PDB)		Q391 D416 V417 S418 Q419 K421 K422 S474 R477 D502 K505
Binding residue
(residue number reindexed from 1)		Q19 D44 V45 S46 Q47 K49 K50 S102 R105 D130 K133
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ml6, PDBe:6ml6, PDBj:6ml6
PDBsum6ml6
PubMed31226215
UniProtQ80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)

[Back to BioLiP]