Structure of PDB 6ml5 Chain A Binding Site BS02

Receptor Information
>6ml5 Chain A (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKK
HLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSD
SSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ml5 Structural basis of specific DNA binding by the transcription factor ZBTB24.
Resolution1.65 Å
Binding residue
(original residue number in PDB)
Q391 D416 V417 S418 Q419 K421 K445 S446 S474 R477
Binding residue
(residue number reindexed from 1)
Q19 D44 V45 S46 Q47 K49 K73 S74 S102 R105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ml5, PDBe:6ml5, PDBj:6ml5
PDBsum6ml5
PubMed31226215
UniProtQ80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)

[Back to BioLiP]