Structure of PDB 6ml3 Chain A Binding Site BS02

Receptor Information
>6ml3 Chain A (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHI
RIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLD
NLKAHLKIHSKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ml3 Structural basis of specific DNA binding by the transcription factor ZBTB24.
Resolution1.683 Å
Binding residue
(original residue number in PDB)
D416 V417 S418 Q419 K421 K445 S474 R477 D502
Binding residue
(residue number reindexed from 1)
D14 V15 S16 Q17 K19 K43 S72 R75 D100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ml3, PDBe:6ml3, PDBj:6ml3
PDBsum6ml3
PubMed31226215
UniProtQ80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)

[Back to BioLiP]