Structure of PDB 6ml2 Chain A Binding Site BS02

Receptor Information

>6ml2 Chain A (length=139) Species: 10090 (Mus musculus)

SKSFTCDQCGKYFSQKRQLKSHYRVHTSLPECSHCHRKFMDVSQLKKHLR
THTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSA
KRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKE

Ligand information

>6ml2 Chain F (length=20)

tttagctgccaggacctgcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ml2 Structural basis of specific DNA binding by the transcription factor ZBTB24.
• Resolution: 1.874 Å
• Binding residue (original residue number in PDB): K445 S474 R477
• Binding residue (residue number reindexed from 1): K70 S99 R102

External links

• PDB: RCSB:6ml2, PDBe:6ml2, PDBj:6ml2
• PDBsum: 6ml2
• PubMed: 31226215
• UniProt: Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 (Gene Name=Zbtb24)