Structure of PDB 6mg3 Chain A Binding Site BS02

Receptor Information

>6mg3 Chain A (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVE
QLSRELSTLRNLFK

Ligand information

>6mg3 Chain D (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatattgcgcaatata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6mg3 Structural basis for effects of CpA modifications on C/EBP beta binding of DNA.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	R280 N281 A284 A285 K287 S288 R289
Binding residue (residue number reindexed from 1)	R12 N13 A16 A17 K19 S20 R21
Binding affinity	PDBbind-CN: Kd=0.004uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6mg3, PDBe:6mg3, PDBj:6mg3
PDBsum	6mg3
PubMed	30566668
UniProt	P17676\|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]