Structure of PDB 6lqf Chain A Binding Site BS02

Receptor Information
>6lqf Chain A (length=175) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKHDCGRAHIQVCSEEEFLRDVMQFLLIRGHTRLVPPGGLAEFPDAVLNS
KRLDLFNLYREVVSRGGFHVGNGINWKGQVFSKMRNHTLTNRMTGVGNTL
KRHYETYLLEYEYAHDDVDGECCLICRSSTAGDWVNCGSCGEWAHFGCDR
RPGLGAFKDYAKTDGLEYVCPNCSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqf Dual Recognition of H3K4me3 and DNA by the ISWI Component ARID5 Regulates the Floral Transition in Arabidopsis.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		A600 V601 N603 S604 R646 T648
Binding residue
(residue number reindexed from 1)		A46 V47 N49 S50 R92 T94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6lqf, PDBe:6lqf, PDBj:6lqf
PDBsum6lqf
PubMed32358072
UniProtQ6NQ79|ARID4_ARATH AT-rich interactive domain-containing protein 4 (Gene Name=ARID4)

[Back to BioLiP]