Structure of PDB 6los Chain A Binding Site BS02

Receptor Information
>6los Chain A (length=369) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPVEEEDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVAT
ALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLK
SASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQ
MKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR
TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLT
MIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSL
FESPDFSKITGKPVKLTQVEHRAAFEWNEEGAGSSFPLDYHLNQPFLFVL
RDTDTGALLFIGRILDPSS
Ligand information
>6los Chain H (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGPPGPPGPKGHRGFSGLPGPPGPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6los Spatiotemporal regulation of PEDF signaling by type I collagen remodeling.
Resolution2.476 Å
Binding residue
(original residue number in PDB)		G253 L254 D257 S291 F296 E303 L304 F383
Binding residue
(residue number reindexed from 1)		G217 L218 D221 S255 F260 E267 L268 F336
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0001822 kidney development
GO:0007614 short-term memory
GO:0010447 response to acidic pH
GO:0010596 negative regulation of endothelial cell migration
GO:0010629 negative regulation of gene expression
GO:0010976 positive regulation of neuron projection development
GO:0014070 response to organic cyclic compound
GO:0016525 negative regulation of angiogenesis
GO:0042698 ovulation cycle
GO:0046685 response to arsenic-containing substance
GO:0050769 positive regulation of neurogenesis
GO:0060041 retina development in camera-type eye
GO:0060767 epithelial cell proliferation involved in prostate gland development
GO:0060770 negative regulation of epithelial cell proliferation involved in prostate gland development
GO:0071279 cellular response to cobalt ion
GO:0071300 cellular response to retinoic acid
GO:0071333 cellular response to glucose stimulus
GO:0071549 cellular response to dexamethasone stimulus
GO:1901652 response to peptide
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0030424 axon
GO:0042470 melanosome
GO:0043025 neuronal cell body
GO:0043203 axon hillock
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6los, PDBe:6los, PDBj:6los
PDBsum6los
PubMed32385162
UniProtP97298|PEDF_MOUSE Pigment epithelium-derived factor (Gene Name=Serpinf1)

[Back to BioLiP]