Structure of PDB 6kdv Chain A Binding Site BS02

Receptor Information
>6kdv Chain A (length=263) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKFRDGLSYLYVEHAVVEREAGGIGIYDQEGLTLAPVAGLGVLFLGPGT
RITHAAVRLLAENGCTVAWVGEGMARFYAQGLGDTRSAARFYRQARAWAD
PALHLEVVMRLYRMRFPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYG
RSYDRGNWRAADPVNRALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKL
LSFVYDIADLYKADYLVPAAFRTVAESEEAVERRVRRALREAIQEGRLLE
RMAEDLLNLFRGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kdv Crystal structure of Cas1 in complex with branched DNA.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		H27 A28 E31 Y40 D41 Q42 G61 R63
Binding residue
(residue number reindexed from 1)		H15 A16 E19 Y28 D29 Q30 G49 R51
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6kdv, PDBe:6kdv, PDBj:6kdv
PDBsum6kdv
PubMed31792780
UniProtQ53WG8|CAS1B_THET8 CRISPR-associated endonuclease Cas1 2 (Gene Name=cas1-2)

[Back to BioLiP]