Structure of PDB 6kal Chain A Binding Site BS02

Receptor Information
>6kal Chain A (length=443) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPRVTVLVREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPR
IPNVRLALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGLLERMV
EALRAGSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALD
GDAVVLLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTFAAARQ
PPLATAHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTR
CFGTVVGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGG
SLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWE
KAVEGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWQDVEFPEHFLQPL
VPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSLT
Ligand information
Ligand IDC5P
InChIInChI=1S/C9H14N3O8P/c10-5-1-2-12(9(15)11-5)8-7(14)6(13)4(20-8)3-19-21(16,17)18/h1-2,4,6-8,13-14H,3H2,(H2,10,11,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
InChIKeyIERHLVCPSMICTF-XVFCMESISA-N
SMILES
SoftwareSMILES
CACTVS 3.341NC1=NC(=O)N(C=C1)[CH]2O[CH](CO[P](O)(O)=O)[CH](O)[CH]2O
OpenEye OEToolkits 1.5.0C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O
CACTVS 3.341NC1=NC(=O)N(C=C1)[C@@H]2O[C@H](CO[P](O)(O)=O)[C@@H](O)[C@H]2O
OpenEye OEToolkits 1.5.0C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O)O)O)O
ACDLabs 10.04O=C1N=C(N)C=CN1C2OC(C(O)C2O)COP(=O)(O)O
FormulaC9 H14 N3 O8 P
NameCYTIDINE-5'-MONOPHOSPHATE
ChEMBLCHEMBL307679
DrugBankDB03403
ZINCZINC000003861744
PDB chain6kal Chain A Residue 503 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kal Crystal structures of fukutin-related protein (FKRP), a ribitol-phosphate transferase related to muscular dystrophy.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		G344 G345 R352 I357 W359 D360 D364 Q437 Q482
Binding residue
(residue number reindexed from 1)		G299 G300 R307 I312 W314 D315 D319 Q388 Q433
Annotation score3
Enzymatic activity
Enzyme Commision number 2.7.8.-
Gene Ontology
Molecular Function
GO:0002162 dystroglycan binding
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
GO:0042802 identical protein binding
GO:0043236 laminin binding
GO:0046872 metal ion binding
Biological Process
GO:0001654 eye development
GO:0001701 in utero embryonic development
GO:0001764 neuron migration
GO:0003007 heart morphogenesis
GO:0003016 respiratory system process
GO:0006096 glycolytic process
GO:0006486 protein glycosylation
GO:0006600 creatine metabolic process
GO:0006629 lipid metabolic process
GO:0006936 muscle contraction
GO:0006954 inflammatory response
GO:0007417 central nervous system development
GO:0007420 brain development
GO:0007507 heart development
GO:0007519 skeletal muscle tissue development
GO:0007628 adult walking behavior
GO:0008104 protein localization
GO:0009100 glycoprotein metabolic process
GO:0009101 glycoprotein biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0010001 glial cell differentiation
GO:0010467 gene expression
GO:0014823 response to activity
GO:0016485 protein processing
GO:0017038 protein import
GO:0019321 pentose metabolic process
GO:0019519 pentitol metabolic process
GO:0030198 extracellular matrix organization
GO:0030282 bone mineralization
GO:0035269 protein O-linked mannosylation
GO:0035437 maintenance of protein localization in endoplasmic reticulum
GO:0036058 filtration diaphragm assembly
GO:0036211 protein modification process
GO:0038026 reelin-mediated signaling pathway
GO:0042692 muscle cell differentiation
GO:0043010 camera-type eye development
GO:0043403 skeletal muscle tissue regeneration
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0050905 neuromuscular process
GO:0051146 striated muscle cell differentiation
GO:0051262 protein tetramerization
GO:0051384 response to glucocorticoid
GO:0051674 localization of cell
GO:0060538 skeletal muscle organ development
GO:0060539 diaphragm development
GO:0061061 muscle structure development
GO:0061448 connective tissue development
GO:0071711 basement membrane organization
GO:0072592 oxygen metabolic process
GO:0097305 response to alcohol
GO:0097709 connective tissue replacement
GO:0098528 skeletal muscle fiber differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0042383 sarcolemma
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kal, PDBe:6kal, PDBj:6kal
PDBsum6kal
PubMed31949166
UniProtQ9H9S5|FKRP_HUMAN Ribitol 5-phosphate transferase FKRP (Gene Name=FKRP)

[Back to BioLiP]