Structure of PDB 6jrf Chain A Binding Site BS02

Receptor Information
>6jrf Chain A (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jrf Structural basis of sequence-specific Holliday junction cleavage by MOC1.
Resolution2.047 Å
Binding residue
(original residue number in PDB)		D117 I118 R148 K175 S177 F179 P180 D182 G186 W187 S189 S213 Q214 T215 K217 M223 R224 K229
Binding residue
(residue number reindexed from 1)		D9 I10 R40 K67 S69 F71 P72 D74 G78 W79 S81 S105 Q106 T107 K109 M115 R116 K121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008821 crossover junction DNA endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:6jrf, PDBe:6jrf, PDBj:6jrf
PDBsum6jrf
PubMed31611704
UniProtB4FCI7

[Back to BioLiP]