Structure of PDB 6jjz Chain A Binding Site BS02

Receptor Information

>6jjz Chain A (length=88) Species: 10090 (Mus musculus)

SDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENEL
PYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQ

Ligand information

>6jjz Chain D (length=13) Species: 10090 (Mus musculus)

DRPPPYVAPPSYE

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6jjz Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity.
• Resolution: 1.65 Å
• Binding residue (original residue number in PDB): D301 P302
• Binding residue (residue number reindexed from 1): D2 P3

External links

• PDB: RCSB:6jjz, PDBe:6jjz, PDBj:6jjz
• PDBsum: 6jjz
• PubMed: 31486770
• UniProt: Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)