Structure of PDB 6jdg Chain A Binding Site BS02

Receptor Information
>6jdg Chain A (length=101) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSEQERTEWHRVVFFGR
LAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIVVDINGNMQLL
G
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jdg Complexed crystal structure of SSB reveals a novel single-stranded DNA binding mode (SSB)3:1: Phe60 is not crucial for defining binding paths.
Resolution2.388 Å
Binding residue
(original residue number in PDB)		R3 R62 E80 Y97 I105 N106
Binding residue
(residue number reindexed from 1)		R1 R50 E68 Y85 I93 N94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jdg, PDBe:6jdg, PDBj:6jdg
PDBsum6jdg
PubMed31604524
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]