Structure of PDB 6j9b Chain A Binding Site BS02

Receptor Information
>6j9b Chain A (length=106) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFH
VWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVI
QARKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9b Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R106 K124 R145 W147 N149
Binding residue
(residue number reindexed from 1)		R18 K36 R57 W59 N61
Binding affinityPDBbind-CN: Kd=162nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:6j9b, PDBe:6j9b, PDBj:6j9b
PDBsum6j9b
PubMed30962525
UniProtQ9LW31|FUS3_ARATH B3 domain-containing transcription factor FUS3 (Gene Name=FUS3)

[Back to BioLiP]