Structure of PDB 6j9a Chain A Binding Site BS02

Receptor Information
>6j9a Chain A (length=106) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGR
EWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIM
GSRKAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9a Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis.
Resolution2.915 Å
Binding residue
(original residue number in PDB)		K297 S300 A301 S302 P313 N351 S354 M356
Binding residue
(residue number reindexed from 1)		K7 S10 A11 S12 P23 N61 S64 M66
Binding affinityPDBbind-CN: Kd=268nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6j9a, PDBe:6j9a, PDBj:6j9a
PDBsum6j9a
PubMed30962525
UniProtQ8W4L5|VAL1_ARATH B3 domain-containing transcription repressor VAL1 (Gene Name=VAL1)

[Back to BioLiP]