Structure of PDB 6hxu Chain A Binding Site BS02

Receptor Information
>6hxu Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGK
QVELALWDTAGLEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVP
EVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRI
QAYDYLECSAKTKEGVREVFETATRAALQKRY
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain6hxu Chain A Residue 202 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hxu A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
Resolution1.19 Å
Binding residue
(original residue number in PDB)		T19 T37
Binding residue
(residue number reindexed from 1)		T18 T36
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0001525 angiogenesis
GO:0006886 intracellular protein transport
GO:0006915 apoptotic process
GO:0007015 actin filament organization
GO:0007155 cell adhesion
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0007266 Rho protein signal transduction
GO:0008333 endosome to lysosome transport
GO:0010595 positive regulation of endothelial cell migration
GO:0015031 protein transport
GO:0030154 cell differentiation
GO:0030334 regulation of cell migration
GO:0030336 negative regulation of cell migration
GO:0043065 positive regulation of apoptotic process
GO:0045766 positive regulation of angiogenesis
GO:0045786 negative regulation of cell cycle
GO:0061154 endothelial tube morphogenesis
GO:0070301 cellular response to hydrogen peroxide
GO:0071479 cellular response to ionizing radiation
GO:0099159 regulation of modification of postsynaptic structure
Cellular Component
GO:0005634 nucleus
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0031902 late endosome membrane
GO:0032154 cleavage furrow
GO:0070062 extracellular exosome
GO:0098685 Schaffer collateral - CA1 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hxu, PDBe:6hxu, PDBj:6hxu
PDBsum6hxu
PubMed31522999
UniProtP62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB (Gene Name=RHOB)

[Back to BioLiP]