Structure of PDB 6hep Chain A Binding Site BS02

Receptor Information

>6hep Chain A (length=230) Species: 9606 (Homo sapiens)

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLEL
LDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQ
EAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI
AELDTLNEESYKDSTLIMQLLRDNLTLWTS

Ligand information

>6hep Chain F (length=15) Species: 9606 (Homo sapiens)

ISVIRRRQSVLNLMT

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6hep A Thermodynamic Model for Multivalency in 14-3-3 Protein-Protein Interactions.
• Resolution: 1.86 Å
• Binding residue (original residue number in PDB): T207 S212 Y213
• Binding residue (residue number reindexed from 1): T205 S210 Y211

Gene Ontology

Molecular Function

• GO:0004860 protein kinase inhibitor activity
• GO:0005515 protein binding
• GO:0019899 enzyme binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0042826 histone deacetylase binding
• GO:0045296 cadherin binding
• GO:0050815 phosphoserine residue binding
• GO:0051219 phosphoprotein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0008104 protein localization
• GO:0043085 positive regulation of catalytic activity
• GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
• GO:0051220 cytoplasmic sequestering of protein

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005773 vacuole
• GO:0005774 vacuolar membrane
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0042470 melanosome
• GO:0048471 perinuclear region of cytoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6hep, PDBe:6hep, PDBj:6hep
• PDBsum: 6hep
• PubMed: 30296824
• UniProt: P31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)