Structure of PDB 6hb4 Chain A Binding Site BS02

Receptor Information
>6hb4 Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hb4 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.
Resolution3.05 Å
Binding residue
(original residue number in PDB)
Y57 T78 I81 R82 A85 W88 R89 K146 K147 K156 R157 R159 N163 A167 F170 P178
Binding residue
(residue number reindexed from 1)
Y14 T35 I38 R39 A42 W45 R46 K103 K104 K113 R114 R116 N120 A124 F127 P135
Binding affinityPDBbind-CN: Kd=4.4nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hb4, PDBe:6hb4, PDBj:6hb4
PDBsum6hb4
PubMed31114891
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]