Structure of PDB 6h7b Chain A Binding Site BS02

Receptor Information
>6h7b Chain A (length=78) Species: 5664 (Leishmania major) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPK
EAYELLNDQKRLEERVTEALCVLKAHQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h7b The Leishmania PABP1-eIF4E4 interface: a novel 5'-3' interaction architecture for trans-spliced mRNAs.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		R546 E549
Binding residue
(residue number reindexed from 1)		R65 E68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6h7b, PDBe:6h7b, PDBj:6h7b
PDBsum6h7b
PubMed30476241
UniProtE9AFX7

[Back to BioLiP]