Structure of PDB 6h22 Chain A Binding Site BS02

Receptor Information
>6h22 Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLY
DAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h22 Water-soluble, stable and azide-reactive strained dialkynes for biocompatible double strain-promoted click chemistry.
Resolution2.006 Å
Binding residue
(original residue number in PDB)		P32 K36
Binding residue
(residue number reindexed from 1)		P15 K19
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h22, PDBe:6h22, PDBj:6h22
PDBsum6h22
PubMed31418442
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]