Structure of PDB 6gcd Chain A Binding Site BS02

Receptor Information
>6gcd Chain A (length=159) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWF
AFLGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPK
TIAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
IFNSGKSVI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gcd Recognition of modified cytosine variants by the DNA-binding domain of methyl-directed endonuclease McrBC.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
S38 G40 Y41 N43 T45 W49 A59 S60 Y64 S83 D84 T85 K116 Y117
Binding residue
(residue number reindexed from 1)
S38 G40 Y41 N43 T45 W49 A59 S60 Y64 S83 D84 T85 K116 Y117
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:6gcd, PDBe:6gcd, PDBj:6gcd
PDBsum6gcd
PubMed30194838
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]