Structure of PDB 6fzs Chain A Binding Site BS02

Receptor Information
>6fzs Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSP
GQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDI
CEFPFGSKQKEVCINPYHYKRVESP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fzs Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes
Resolution2.31 Å
Binding residue
(original residue number in PDB)		R75 H101 H102
Binding residue
(residue number reindexed from 1)		R66 H92 H93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fzs, PDBe:6fzs, PDBj:6fzs
PDBsum6fzs
PubMed
UniProtQ99717|SMAD5_HUMAN Mothers against decapentaplegic homolog 5 (Gene Name=SMAD5)

[Back to BioLiP]