Structure of PDB 6fqq Chain A Binding Site BS02

Receptor Information
>6fqq Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINAR
RRLLPDMLRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fqq TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-beta signaling.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
Y191 K197 R219 R220
Binding residue
(residue number reindexed from 1)
Y22 K28 R50 R51
Binding affinityPDBbind-CN: Kd=388.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6fqq, PDBe:6fqq, PDBj:6fqq
PDBsum6fqq
PubMed30060237
UniProtQ15583|TGIF1_HUMAN Homeobox protein TGIF1 (Gene Name=TGIF1)

[Back to BioLiP]