Structure of PDB 6fqp Chain A Binding Site BS02

Receptor Information
>6fqp Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFIN
ARRRLLPDMLRKDGKDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fqp TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-beta signaling.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		R168 Y191 K197 I216 R219 R220
Binding residue
(residue number reindexed from 1)		R1 Y24 K30 I49 R52 R53
Binding affinityPDBbind-CN: Kd=169.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fqp, PDBe:6fqp, PDBj:6fqp
PDBsum6fqp
PubMed30060237
UniProtQ15583|TGIF1_HUMAN Homeobox protein TGIF1 (Gene Name=TGIF1)

[Back to BioLiP]