Structure of PDB 6fi8 Chain A Binding Site BS02

Receptor Information

>6fi8 Chain A (length=127) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEI
IEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPT
LWTNSCFISTVGGAPLNVVKQYIENQQ

Ligand information

>6fi8 Chain D (length=29) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaagcccctagcttttagctatggggata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6fi8 Targeting IS608 transposon integration to highly specific sequences by structure-based transposon engineering.
Resolution	2.598 Å
Binding residue (original residue number in PDB)	S9 N10 H11 N12 V14 L51 R52 D72 S74 F75
Binding residue (residue number reindexed from 1)	S4 N5 H6 N7 V9 L46 R47 D67 S69 F70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6fi8, PDBe:6fi8, PDBj:6fi8
PDBsum	6fi8
PubMed	29635476
UniProt	Q933Z0

[Back to BioLiP]