Structure of PDB 6fbq Chain A Binding Site BS02

Receptor Information
>6fbq Chain A (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLI
DKRQRNRCQYCRYQKCLAMGMKREAVQEER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fbq Modulation of RXR-DNA complex assembly by DNA context.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
E153 G154 R161 R184 N185 Q188 R191
Binding residue
(residue number reindexed from 1)
E24 G25 R32 R55 N56 Q59 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6fbq, PDBe:6fbq, PDBj:6fbq
PDBsum6fbq
PubMed30476562
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]