Structure of PDB 6f8g Chain A Binding Site BS02

Receptor Information
>6f8g Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNP
KGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAY
RFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f8g The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation.
Resolution2.03 Å
Binding residue
(original residue number in PDB)
N62 K64 P94
Binding residue
(residue number reindexed from 1)
N39 K41 P71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6f8g, PDBe:6f8g, PDBj:6f8g
PDBsum6f8g
PubMed30449689
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]