Structure of PDB 6e93 Chain A Binding Site BS02

Receptor Information
>6e93 Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHER
IHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLST
KRNHEQRHIREH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e93 Structural insights into methylated DNA recognition by the C-terminal zinc fingers of the DNA reader protein ZBTB38.
Resolution1.747 Å
Binding residue
(original residue number in PDB)
Y1010 S1021 P1022 S1023 K1055 E1079 R1093
Binding residue
(residue number reindexed from 1)
Y2 S13 P14 S15 K47 E71 R85
Binding affinityPDBbind-CN: Kd=5nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6e93, PDBe:6e93, PDBj:6e93
PDBsum6e93
PubMed30355731
UniProtQ8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 (Gene Name=ZBTB38)

[Back to BioLiP]