Structure of PDB 6e8c Chain A Binding Site BS02

Receptor Information
>6e8c Chain A (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQI
WFQNERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEK
DRFPGIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e8c Crystal Structure of the Double Homeodomain of DUX4 in Complex with DNA.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		R20 R23 Y43 Q64 R71 S72 R79 R95 R96 R98 T99 R137 I140 W141 N144 R148
Binding residue
(residue number reindexed from 1)		R5 R8 Y28 Q49 R56 S57 R64 R80 R81 R83 T84 R122 I125 W126 N129 R133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6e8c, PDBe:6e8c, PDBj:6e8c
PDBsum6e8c
PubMed30540931
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]