Structure of PDB 6dox Chain A Binding Site BS02

Receptor Information
>6dox Chain A (length=136) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEF
LAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWK
LVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dox Cation trafficking propels RNA hydrolysis.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
D71 V72 G73 S74 G76 N77 N105 R195 K196
Binding residue
(residue number reindexed from 1)
D11 V12 G13 S14 G16 N17 N45 R135 K136
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:6dox, PDBe:6dox, PDBj:6dox
PDBsum6dox
PubMed30076410
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]