Structure of PDB 6dmn Chain A Binding Site BS02

Receptor Information
>6dmn Chain A (length=135) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEF
LAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWK
LVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dmn Cation trafficking propels RNA hydrolysis.
Resolution1.27 Å
Binding residue
(original residue number in PDB)
D71 V72 G73 S74 N77 N105
Binding residue
(residue number reindexed from 1)
D11 V12 G13 S14 N17 N45
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:6dmn, PDBe:6dmn, PDBj:6dmn
PDBsum6dmn
PubMed30076410
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]