Structure of PDB 6dfb Chain A Binding Site BS02

Receptor Information
>6dfb Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTAHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dfb A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		Y522 A534 E535 T538 R549 Y550 Y562 Q563 S578 Y584 L586 R595 Y597
Binding residue
(residue number reindexed from 1)		Y42 A54 E55 T58 R69 Y70 Y82 Q83 S98 Y104 L106 R115 Y117
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dfb, PDBe:6dfb, PDBj:6dfb
PDBsum6dfb
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]