Structure of PDB 6df9 Chain A Binding Site BS02

Receptor Information
>6df9 Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVF
PLAQYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDS
KLYRLHPCRSLQIRQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6df9 A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution2.319 Å
Binding residue
(original residue number in PDB)		R511 K520 A534 Q535 T538 R549 Y550 Y562 Q563 Y584 L586 R595 Y597
Binding residue
(residue number reindexed from 1)		R30 K39 A53 Q54 T57 R68 Y69 Y81 Q82 Y103 L105 R114 Y116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6df9, PDBe:6df9, PDBj:6df9
PDBsum6df9
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]