Structure of PDB 6df8 Chain A Binding Site BS02

Receptor Information
>6df8 Chain A (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVF
PLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDS
KLYRLHPCRSLQIRQYAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6df8 A conformational switch in the zinc finger protein Kaiso mediates differential readout of specific and methylated DNA sequences.
Resolution2.536 Å
Binding residue
(original residue number in PDB)		K520 A534 E535 T538 R549 Y550 Y562 Q563 S578 Y584 L586 R595 Y597
Binding residue
(residue number reindexed from 1)		K39 A53 E54 T57 R68 Y69 Y81 Q82 S97 Y103 L105 R114 Y116
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6df8, PDBe:6df8, PDBj:6df8
PDBsum6df8
PubMed32352758
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]