Structure of PDB 6dcl Chain A Binding Site BS02

Receptor Information
>6dcl Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG
FGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKK
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH
DSVDKIVIQKYHTVNGHNCEVRKALSKQEMAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dcl Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		K106 F108 G110 G111 E114 K145 R146 G147 F148 F150 E176 R178 A180 L181 S182 K183 M186
Binding residue
(residue number reindexed from 1)		K100 F102 G104 G105 E108 K139 R140 G141 F142 F144 E170 R172 A174 L175 S176 K177 M180
Binding affinityPDBbind-CN: Kd=15.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6dcl, PDBe:6dcl, PDBj:6dcl
PDBsum6dcl
PubMed29946118
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]