Structure of PDB 6d3x Chain A Binding Site BS02

Receptor Information
>6d3x Chain A (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FDCGKPQVEPKKCPVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEW
VLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDI
ALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLL
KEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVC
FEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d3x Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin Inhibitor-1 Scaffold Attenuate Fibrinolysis in Plasma.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E606 P609 L638 L640
Binding residue
(residue number reindexed from 1)		E59 P62 L91 L93
Enzymatic activity
Catalytic site (original residue number in PDB) H603 D646 Q738 G739 D740 S741
Catalytic site (residue number reindexed from 1) H56 D99 Q191 G192 D193 S194
Enzyme Commision number 3.4.21.7: plasmin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6d3x, PDBe:6d3x, PDBj:6d3x
PDBsum6d3x
PubMed30520638
UniProtP00747|PLMN_HUMAN Plasminogen (Gene Name=PLG)

[Back to BioLiP]