Structure of PDB 6d1t Chain A Binding Site BS02

Receptor Information
>6d1t Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTR
YLGPACDLTLFDFKQGIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d1t Complex of MBD1-MBD and methylated DNA
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R44 S45 K46 K65
Binding residue
(residue number reindexed from 1)		R43 S44 K45 K64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6d1t, PDBe:6d1t, PDBj:6d1t
PDBsum6d1t
PubMed
UniProtQ9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Gene Name=MBD1)

[Back to BioLiP]