Structure of PDB 6cro Chain A Binding Site BS02

Receptor Information
>6cro Chain A (length=60) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVY
AEEVKPFPSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cro Crystal structure of lambda-Cro bound to a consensus operator at 3.0 A resolution.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G15 Q16 V25 Y26 Q27 S28 N31 K32 H35 R38
Binding residue
(residue number reindexed from 1)		G14 Q15 V24 Y25 Q26 S27 N30 K31 H34 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0009411 response to UV
GO:0010944 negative regulation of transcription by competitive promoter binding
GO:0019042 viral latency
GO:0019046 release from viral latency
GO:0032897 negative regulation of viral transcription
GO:0098689 latency-replication decision

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6cro, PDBe:6cro, PDBj:6cro
PDBsum6cro
PubMed9653037
UniProtP03040|RCRO_LAMBD Regulatory protein cro (Gene Name=cro)

[Back to BioLiP]