Structure of PDB 6ci5 Chain A Binding Site BS02

Receptor Information
>6ci5 Chain A (length=189) Species: 1212546 (Anoxybacillus ayderensis G10) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKILLLGPERKWLRDFLESFEDEVTQYQDKLDKKSAILNNVDFIISYGYR
YIIHPDIVERFKQRAINLHISYLPWNKGADPNLWSFLEDSPKGVTIHYID
SGLDTGEIIVQREVTYYENDTLRTTYERLTQTIEKLFMEYWPLIRLGKIR
GIPQPKGGSYHKLKDKEKYLYLLTDGWDTPVQKLIGKAQ
Ligand information
Ligand ID1YJ
InChIInChI=1S/C19H23N7O6/c20-19-25-15-14(17(30)26-19)23-11(8-22-15)7-21-10-3-1-9(2-4-10)16(29)24-12(18(31)32)5-6-13(27)28/h1-4,11-12,21,23H,5-8H2,(H,24,29)(H,27,28)(H,31,32)(H4,20,22,25,26,30)/t11-,12+/m1/s1
InChIKeyMSTNYGQPCMXVAQ-NEPJUHHUSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC[C@@H]2CNC3=C(N2)C(=O)NC(=N3)N
CACTVS 3.385NC1=NC2=C(N[CH](CNc3ccc(cc3)C(=O)N[CH](CCC(O)=O)C(O)=O)CN2)C(=O)N1
OpenEye OEToolkits 1.7.6c1cc(ccc1C(=O)NC(CCC(=O)O)C(=O)O)NCC2CNC3=C(N2)C(=O)NC(=N3)N
CACTVS 3.385NC1=NC2=C(N[C@H](CNc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)CN2)C(=O)N1
ACDLabs 12.01O=C(O)C(NC(=O)c1ccc(cc1)NCC3NC2=C(N=C(N)NC2=O)NC3)CCC(=O)O
FormulaC19 H23 N7 O6
NameN-[4-({[(6R)-2-amino-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid
ChEMBLCHEMBL2074655
DrugBank
ZINCZINC000004228235
PDB chain6ci5 Chain A Residue 303 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ci5 Structural Insight into a Novel Formyltransferase and Evolution to a Nonribosomal Peptide Synthetase Tailoring Domain.
Resolution2.00003 Å
Binding residue
(original residue number in PDB)		I78 N92 I124 D125 D129
Binding residue
(residue number reindexed from 1)		I53 N67 I99 D100 D104
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 17:49:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6ci5', asym_id = 'A', bs = 'BS02', title = 'Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6ci5', asym_id='A', bs='BS02', title='Structural Insight into a Novel Formyltransferas...Nonribosomal Peptide Synthetase Tailoring Domain.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009058', uniprot = '', pdbid = '6ci5', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009058', uniprot='', pdbid='6ci5', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>