Structure of PDB 6chv Chain A Binding Site BS02

Receptor Information
>6chv Chain A (length=89) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLS
IRIAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6chv Structural basis of transcriptional regulation by the HigA antitoxin.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T34 A36 T37 R40 T46 A47 T49 L52
Binding residue
(residue number reindexed from 1)		T31 A33 T34 R37 T43 A44 T46 L49
Binding affinityPDBbind-CN: Kd=125nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6chv, PDBe:6chv, PDBj:6chv
PDBsum6chv
PubMed30793388
UniProtQ7A224|HIGA_PROVU Antitoxin HigA (Gene Name=higA)

[Back to BioLiP]