Structure of PDB 6cc8 Chain A Binding Site BS02

Receptor Information
>6cc8 Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
RYLGGSMDLSTFDFRTGKMLM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cc8 Structural analyses reveal that MBD3 is a methylated CG binder.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R44 S45
Binding residue
(residue number reindexed from 1)		R44 S45
Binding affinityPDBbind-CN: Kd=5.4uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6cc8, PDBe:6cc8, PDBj:6cc8
PDBsum6cc8
PubMed30980593
UniProtO95983|MBD3_HUMAN Methyl-CpG-binding domain protein 3 (Gene Name=MBD3)

[Back to BioLiP]